PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC026591.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 345aa    MW: 38082.8 Da    PI: 4.3915
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC026591.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.15.6e-30177230155
       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   +prl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  EcC026591.10 177 RPRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 230
                   59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.52174233IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-30174235IPR009057Homeodomain-like
SuperFamilySSF466892.69E-19174234IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-23178230IPR006447Myb domain, plants
PfamPF002496.2E-8180229IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009735Biological Processresponse to cytokinin
GO:0045037Biological Processprotein import into chloroplast stroma
GO:0048598Biological Processembryonic morphogenesis
GO:0005774Cellular Componentvacuolar membrane
GO:0031359Cellular Componentintegral component of chloroplast outer membrane
GO:0003677Molecular FunctionDNA binding
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGETGEEVKM SESDDLHHGR GGGSGDGELD GEDPVAEWEF GLPSCDDLAP LSQALIPPDL  60
ASAFSIALRP SRTAGDVNRA SRSTLTGLRR CGSTASSQGF STNDNFKSFV DDRQSMEVEV  120
EEEVKEEEEE DEEEEEEDGA DKSDSRKSRR IETAEEVDST PRMDDSQEDP SEKTSKRPRL  180
VWTPQLHKRF VDVVAHLGIK NAVPKTIMQL MNVEGLTREN VASHLQKYRL YLRRMQGMSS  240
EGLSSSDQLF TSTPVVHSLN DVAGSTGHGN GQMPMPTPLP YGAQPPMMPM PFYAMGHGYG  300
HMGMQIGDLS GFESNQYVTQ QRDWSSNKYG SVASYQQTAS NEERF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-20176235463ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010043501.10.0PREDICTED: transcription factor PCL1-like
SwissprotQ9SNB41e-82PCL1_ARATH; Transcription factor LUX
TrEMBLA0A059D5N90.0A0A059D5N9_EUCGR; Uncharacterized protein
STRINGVIT_06s0004g05120.t011e-107(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.26e-77G2-like family protein